/ Miscellaneous

React rerelease of MSAViewer

React rerelease of MSAViewer

react-msa-viewer

react-msa-viewer is a performant, extendable, highly-customizable, production-ready React Component that renders a Multiple Sequence Alignment (MSA).

WARNING: Work in progress - use with caution

Getting started

import MSAViewer from '@plotly/react-msa-viewer';

function MSA() {
  const options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
    colorScheme: "zappo",
  };
  return (
    <MSAViewer {...options} />
  );
}

Open on CodePen

Installation

For npm users, run:

npm i --save @plotly/react-msa-viewer

For yarn users, run:

yarn add @plotly/react-msa-viewer

Use your own layout

<MSAViewer> acts a Context Provider for all MSA subcomponents.
Hence, it will automatically take care of synchronization between all MSA components in its tree:

import {
  Labels,
  MSAViewer,
  OverviewBar,
  PositionBar,
  SequenceOverview,
  SequenceViewer,
} from '@plotly/react-msa-viewer';

function MSA() {
  const options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
  };
  return (
    <MSAViewer {...options}>
      <SequenceOverview method="information-content"/>
      <div style={{display: "flex"}} >
        <div>
          <SequenceViewer/>
          <br/>
          <OverviewBar/>
          <PositionBar/>
        </div>
        <Labels/>
      </div>
    </MSAViewer>
  );
}

Open on CodePen

Usage in Vanilla JS

Using the react-msa-viewer with React is highly recommended.
However, it can be used in Vanilla JS:

<html>
<meta charset="utf-8" />
<script src="https://cdnjs.cloudflare.com/ajax/libs/react/15.4.2/react.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/react-dom/15.4.2/react-dom.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/prop-types/15.5.2/prop-types.js"></script>
<script src="https://unpkg.com/@plotly/react-msa-viewer/dist/index.umd.min.js"></script>
<body>
  <div id="my-msa" />
  <script>
  var options = {
    sequences: [
      {
        name: "seq.1",
        sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
      },
      {
        name: "seq.2",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
      {
        name: "seq.3",
        sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
      },
    ],
    colorScheme: "zappo",
   };
  ReactDOM.render(
    React.createElement(ReactMSAViewer.MSAViewer, options),
    document.getElementById('my-msa')
  );
  </script>
</body>
</html>

See an example on CodePen.

Props

Warning: these properties are still susceptible to a change at any moment.

MSAViewer (component)

A general-purpose layout for the MSA components

When children are passed it acts as a Context Provider for the msaStore,
otherwise it provides a default layout and forwards it props the respective
components.

Props

barAttributes

Attributes to apply to each bar.

type: object

barFillColor

Fill color of the OverviewBar, e.g. #999999

type: string

barMethod

Method to use for the OverviewBar:

  • information-content: Information entropy after Shannon of a column (scaled)
  • conservation: Conservation of a column (scaled)

type: enum('information-content'|'conservation')

barStyle

Inline styles to apply to each bar.

type: object

colorScheme

Colorscheme to use. Currently the follow colorschemes are supported:
buried_index, clustal, clustal2, cinema, helix_propensity, hydro,
lesk, mae, nucleotide, purine_pyrimidine, strand_propensity, taylor,
turn_propensity, and zappo.

See msa-colorschemes for details.

type: custom

height

Height of the sequence viewer (in pixels), e.g. 500.

type: number

labelAttributes

Attributes to apply to each label.

type: object

labelComponent

Component to create labels from.

type: union(object|func)

labelStyle

Inline styles to apply to each label.

type: object

layout

Predefined layout scheme to use (only used when no child elements are provided).
Available layouts: basic, inverse, full, compact, funky

type: enum('basic'|'default'|'inverse'|'full'|'compact'|'funky')

markerAttributes

Attributes to apply to each marker.

type: object

markerComponent

Component to create markers from.

type: union(object|func)

markerStartIndex

At which number the PositionBar marker should start counting.
Typical values are: 1 (1-based indexing) and 0 (0-based indexing).

type: number

markerSteps

At which steps the position labels should appear, e.g. 2 for (1, 3, 5)

type: number

markerStyle

Inline styles to apply to each marker.

type: object

msaStore

A custom msaStore (created with createMSAStore).
Useful for custom interaction with other components

type: object

onResidueClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueDoubleClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueMouseEnter

Callback fired when the mouse pointer is entering a residue.

type: func

onResidueMouseLeave

Callback fired when the mouse pointer is leaving a residue.

type: func

position

Current x and y position of the viewpoint
in the main sequence viewer (in pixels).
This specifies the position of the top-left corner
of the viewpoint within the entire alignment,
e.g. {xPos: 20, yPos: 5}.

type: custom

sequenceBorder

Whether to draw a border.

type: bool

sequenceBorderColor

Color of the border. Name, hex or RGB value.

type: string

sequenceBorderWidth

Width of the border.

type: number

sequenceOverflow

What should happen if content overflows.

type: enum("hidden"|"auto"|"scroll")

sequenceOverflowX

What should happen if x-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial")

sequenceOverflowY

What should happen if y-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial")

sequenceScrollBarPositionX

X Position of the scroll bar ("top or "bottom")

type: enum("top"|"bottom")

sequenceScrollBarPositionY

Y Position of the scroll bar ("left" or "right")

type: enum("left"|"right")

sequenceTextColor

Color of the text residue letters (name, hex or RGB value)

type: string

sequenceTextFont

Font to use when drawing the individual residues.

type: string

sequences (required)

Sequence data.
sequences expects an array of individual sequences.

sequence: Raw sequence, e.g. MEEPQSDPSIEP (required)
name: name of the sequence, e.g. Sequence X

Example:

const sequences = [
  {
    name: "seq.1",
    sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED",
  },
  {
    name: "seq.2",
    sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP",
  },
];

type: arrayOf[SequencePropType]

tileHeight

Height of the main tiles (in pixels), e.g. 20

type: number

tileWidth

Width of the main tiles (in pixels), e.g. 20

type: number

width

Width of the sequence viewer (in pixels), e.g. 500.

type: number

Labels (component)

Displays the sequence names.

Props

cacheElements

defaultValue: 10

font

Font of the sequence labels, e.g. 20px Arial

type: string

labelAttributes

Attributes to apply to each label.

type: object

labelComponent

Component to create labels from.

type: union(object|func)

labelStyle

Inline styles to apply to each label.

type: object
defaultValue: {}

style

Inline styles to apply to the Label component

type: object

OverviewBar (component)

Creates a small overview box of the sequences for a general overview.

Props

engine

Rendering engine: canvas or webgl (experimental).

type: enum('canvas'|'webgl')
defaultValue: "canvas"

fillColor

Fill color of the OverviewBar, e.g. #999999

type: string
defaultValue: "#999999"

height (required)

Width of the component (in pixels), e.g. 100

type: number
defaultValue: 50

method

Method to use for the OverviewBar:

  • information-content: Information entropy after Shannon of a column (scaled)
  • conservation: Conservation of a column (scaled)

type: enum('information-content'|'conservation')
defaultValue: "conservation"

style

Custom style configuration.

type: object

width (required)

Width of the component (in pixels), e.g. 100

type: number

PositionBar (component)

Displays the sequence names with an arbitrary Marker component

Props

cacheElements

defaultValue: 10

font

Font of the sequence labels, e.g. 20px Arial

type: string

height

Height of the PositionBar (in pixels), e.g. 100

type: number
defaultValue: 15

markerAttributes

Attributes to apply to each marker.

type: object

markerComponent

Component to create markers from.

type: union(object|func)

markerSteps

At which steps the position labels should appear, e.g. 2 for (1, 3, 5)

type: number
defaultValue: 2

markerStyle

Inline styles to apply to each marker.

type: object
defaultValue: {}

startIndex

At which number the PositionBar marker should start counting.
Typical values are: 1 (1-based indexing) and 0 (0-based indexing).

type: number
defaultValue: 1

style

Inline styles to apply to the PositionBar component

type: object
defaultValue: { font: "12px Arial", }

SequenceOverview (component)

Props

engine

Rendering engine: canvas or webgl (experimental).

type: enum('canvas'|'webgl')
defaultValue: "canvas"

height (required)

Width of the component (in pixels), e.g. 100

type: number
defaultValue: 50

style

Custom style configuration.

type: object

tileHeight

Height of a tile in the OverviewBar, e.g. 5

type: number
defaultValue: 5

tileWidth

Width of a tile in the OverviewBar, e.g. 5

type: number
defaultValue: 5

width (required)

Width of the component (in pixels), e.g. 100

type: number

SequenceViewer (component)

Component to draw the main sequence alignment.

Props

border

Whether to draw a border.

type: bool
defaultValue: false

borderColor

Color of the border. Name, hex or RGB value.

type: string
defaultValue: "black"

borderWidth

Width of the border.

type: number
defaultValue: 1

cacheElements

Number of residues to prerender outside of the visible viewbox.

type: number
defaultValue: 20

onResidueClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueDoubleClick

Callback fired when the mouse pointer clicked a residue.

type: func

onResidueMouseEnter

Callback fired when the mouse pointer is entering a residue.

type: func

onResidueMouseLeave

Callback fired when the mouse pointer is leaving a residue.

type: func

overflow

What should happen if content overflows.

type: enum("hidden"|"auto"|"scroll")
defaultValue: "hidden"

overflowX

What should happen if x-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial")
defaultValue: "auto"

overflowY

What should happen if y-axis content overflows (overwrites "overflow")

type: enum("hidden"|"auto"|"scroll"|"initial")
defaultValue: "auto"

scrollBarPositionX

X Position of the scroll bar ("top or "bottom")

type: enum("top"|"bottom")
defaultValue: "bottom"

scrollBarPositionY

Y Position of the scroll bar ("left" or "right")

type: enum("left"|"right")
defaultValue: "right"

showModBar

Show the custom ModBar

type: bool
defaultValue: false

textColor

Color of the text residue letters (name, hex or RGB value)

type: string
defaultValue: "black"

textFont

Font to use when drawing the individual residues.

type: string
defaultValue: "18px Arial"

xGridSize

Number of residues to cluster in one tile (x-axis) (default: 10)

type: number
defaultValue: 10

yGridSize

Number of residues to cluster in one tile (y-axis) (default: 10)

type: number
defaultValue: 10

Creating your own MSA components

The React MSA Viewer uses an Redux store internally.
You can connect your components with it too.

import React, {Component} from 'react';
import {
  msaConnect,
  MSAViewer,
  SequenceViewer,
} from '@plotly/react-msa-viewer';

class MyFirstMSAPluginComponent extends React.Component {
  render() {
    const residue = "E";
    const style = {
      width: this.props.tileWidth,
      height: this.props.tileHeight,
      backgroundColor: this.props.colorScheme.getColor(residue),
    }
    return (
      <div style={style}>
        {residue}
      </div>
    );
  }
}

const mapStateToProps = state => {
  return {
    tileHeight: state.props.tileHeight,
    tileWidth: state.props.tileWidth,
    colorScheme: state.props.colorScheme,
  }
}

const MyFirstMSAPlugin = msaConnect(
  mapStateToProps,
)(MyFirstMSAPluginComponent);

function MyMSA() {
  return (
    <MSAViewer sequences={sequences}>
      <SequenceViewer />
      <br />
      <MyFirstMSAPlugin />
    </MSAViewer>
  );
}

Open on CodePen

However, for performance reasons you need to use a special mixin to listen for
position events.

import {
  withPositionStore,
  MSAViewer,
  SequenceViewer,
} from '@plotly/react-msa-viewer';


class MyFirstMSAPlugin extends React.Component {
  shouldRerender(newPosition) {
     return true;
  }
  render() {
    return (
      <div>
        x: {this.position.xPos}, y: {this.position.yPos}
      </div>
    );
  }
}

// inject the MSAPositionStore as this.position
withPositionStore(MyFirstMSAPlugin);

function MyMSA() {
  return (
    <MSAViewer sequences={sequences}>
      <SequenceViewer />
      <MyFirstMSAPlugin />
    </MSAViewer>
  );
}

ReactDOM.render(<MyMSA />, document.getElementById("my-msa"));

Open on CodePen

Alternatively, you can also listen to events.

Listen to events

The MSAViewer components (and its subcomponents) provide a variety of callbacks
like onResidueClick that can be used to plug with your code:

import {
  MSAViewer,
} from 'react-msa-viewer';

function MyMSA() {
  return <MSAViewer sequences={sequences} onResidueClick={console.log} />
}

Open on CodePen

Some events also trigger custom DOM events which might simply subscription
outside of React:

<html>
<meta charset="utf-8" />
<script src="https://cdnjs.cloudflare.com/ajax/libs/react/15.4.2/react.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/react-dom/15.4.2/react-dom.min.js"></script>
<script src="https://cdnjs.cloudflare.com/ajax/libs/prop-types/15.5.2/prop-types.js"></script>
<script src="https://unpkg.com/@plotly/react-msa-viewer/dist/index.umd.min.js"></script>
<body>
  <div id="my-msa" />
  <script>
    var options = {
      sequences: [
        {
          name: "seq.1",
          sequence: "MEEPQSDPSIEP-PLSQETFSDLWKLLPENNVLSPLPS-QA-VDDLMLSPDDLAQWLTED"
        },
        {
          name: "seq.2",
          sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
        },
        {
          name: "seq.3",
          sequence: "MEEPQSDLSIEL-PLSQETFSDLWKLLPPNNVLSTLPS-SDSIEE-LFLSENVAGWLEDP"
        }
      ],
      colorScheme: "zappo"
    };
    var el = document.getElementById("my-msa");
    ReactDOM.render(React.createElement(ReactMSAViewer.MSAViewer, options), el);
    el.addEventListener('residueClick', (e) => console.log(e.detail));
  </script>
</body>
</html>

Open on CodePen.

The custom DOM events bubble up the tree and contain their payload in.detail.

Sending actions

While the most common way to update the MSA is to update its properties, you
can also send a variety of actions to the MSAViewer.

import {
  MSAViewer,
} from 'react-msa-viewer';

class MyMSA extends React.Component {
  moveLeft = () => {
    this.msa.movePosition({yMovement: -10})
  }
  moveRight = () => {
    this.msa.movePosition({yMovement: 10})
  }
  jumpOrigin = () => {
    debugger;
    this.msa.movePosition({yPos: 0})
  }
  render() {
    return (
      <div>
        <MSAViewer sequences={sequences} ref={(ref) => this.msa = ref} />
        <button onClick={this.moveLeft}>Move left</button>
        <button onClick={this.moveRight}>Move right</button>
        <button onClick={this.jumpOrigin}>Jump to the origin</button>
      </div>
    );
  }
}

Open on CodePen

It's also possible to use actions to create a payload and dispatch it later:

import {
  MSAViewer,
} from 'react-msa-viewer';

class MyMSA extends React.Component {
  moveLeft = () => {
    const payload = actions.movePosition({yMovement: -10});
    this.msa.dispatch(payload);
  }
  moveRight = () => {
    const payload = actions.movePosition({yMovement: 10});
    this.msa.dispatch(payload);
  }
  jumpOrigin = () => {
    const payload = actions.updatePosition({yPos: 0});
    this.msa.dispatch(payload);
  }
  render() {
    return (
      <div>
        <MSAViewer sequences={sequences} ref={(ref) => this.msa = ref} />
        <button onClick={this.moveLeft}>Move left</button>
        <button onClick={this.moveRight}>Move right</button>
        <button onClick={this.jumpOrigin}>Jump to the origin</button>
      </div>
    );
  }
}

Development

Getting started

Get the code:

git clone https://github.com/plotly/react-msa-viewer

Install the project dev dependencies:

npm install

GitHub